Product Parameters
| Catalog number | GT-B031 |
|---|---|
| CAS number | 863919-85-1 |
| Sequence | KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY-NH2(Disulfidebond : 2-7) |
| One-letter sequence | Confirm against the current product specification |
| Molecular formula | C152H248N50O49S2 |
| Molecular weight | Confirm against the current product specification |
| Available purity | Confirm against the current product specification |
| Appearance | Confirm against the current product specification |
| Storage guidance | d at room temperature without damage. Please freeze and store immediately after receipt. What problems should be paid attention to in the |
Supply & Quality Options
Lyophilized powder, bulk material, development sample or custom-filled vial, subject to technical feasibility.
Current specification and batch COA; TDS, SDS and analytical documentation are confirmed by product and project.
Purity, salt form, fill quantity, packaging, analytical testing and scale can be reviewed for qualified B2B projects.
Packaging and temperature controls are selected against material stability, route, season and destination requirements.
Product Overview
This catalog entry supports qualified B2B sourcing and technical evaluation. Identity data is organized for product matching; final salt form, purity, analytical methods, manufacturing grade, packaging and regulatory documentation are confirmed against the current quotation and quality agreement.
Documentation Available for Review
- Current product specification and identity confirmation
- Batch-specific certificate of analysis where applicable
- Analytical documentation aligned to the agreed quality package
- Storage, packaging and shipment guidance
- GMP, sterile, clinical or injectable-development documentation when specifically applicable and contracted
Commercial Information
MOQ, sample quantity, lead time, packaging, shipping conditions and recurring supply plans are quoted against the required grade, quantity and destination. Custom synthesis and scale-up can be evaluated from the target identity and quality brief.

