◆ Factory-Direct Cosmetic Peptide Powder ◆ OEM / ODM Private Label Service ◆ COA-TDS-MSDS Available ◆ Sample & Bulk Orders Supported ◆ Global B2B Export ◆ Custom Lyophilized Vial Kits ◆ Request Your Project Quote Today ◆
cecropinb professional product presentation
Pharmaceutical & Therapeutic Peptides

cecropinb

cecropinb — structured English B2B identity and sourcing information for pharmaceutical development / qualified B2B. Final grade, specification, documents and availability are confirmed per inquiry.

CAS80451-05-4Catalog No.GT-P06Project scopePharmaceutical development / qualified B2B

Request Quote & Documents

IDENTITY & SPECIFICATION

Product Parameters

Catalog numberGT-P06
CAS number80451-05-4
SequenceLys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 ( KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 )
One-letter sequenceConfirm against the current product specification
Molecular formulaC176H301N51O42S1
Molecular weight3734.73
Available purity>=95.0%
AppearanceWhite powder
Storage guidanceStore lyophilized at -20 degrees C and protect from light

Supply & Quality Options

Supply format

Lyophilized powder, bulk material, development sample or custom-filled vial, subject to technical feasibility.

Quality package

Current specification and batch COA; TDS, SDS and analytical documentation are confirmed by product and project.

Custom development

Purity, salt form, fill quantity, packaging, analytical testing and scale can be reviewed for qualified B2B projects.

Shipping controls

Packaging and temperature controls are selected against material stability, route, season and destination requirements.

Product Overview

This catalog entry supports qualified B2B sourcing and technical evaluation. Identity data is organized for product matching; final salt form, purity, analytical methods, manufacturing grade, packaging and regulatory documentation are confirmed against the current quotation and quality agreement.

Documentation Available for Review

  • Current product specification and identity confirmation
  • Batch-specific certificate of analysis where applicable
  • Analytical documentation aligned to the agreed quality package
  • Storage, packaging and shipment guidance
  • GMP, sterile, clinical or injectable-development documentation when specifically applicable and contracted

Commercial Information

MOQ, sample quantity, lead time, packaging, shipping conditions and recurring supply plans are quoted against the required grade, quantity and destination. Custom synthesis and scale-up can be evaluated from the target identity and quality brief.

Professional-use and regulatory notice

This listing supports qualified B2B pharmaceutical and clinical-development discussions. Grade, GMP scope, sterility, endotoxin limits, injectable-development suitability, documentation and destination-market pathway must be confirmed for the exact project. A catalog entry is not a marketing authorization or an approved therapeutic indication.

Scroll to Top