◆ Factory-Direct Cosmetic Peptide Powder ◆ OEM / ODM Private Label Service ◆ COA-TDS-MSDS Available ◆ Sample & Bulk Orders Supported ◆ Global B2B Export ◆ Custom Lyophilized Vial Kits ◆ Request Your Project Quote Today ◆
Amyloid β-Protein (1-42) (mouse professional product presentation
Research & Catalog Peptides

Amyloid β-Protein (1-42) (mouse

Amyloid β-Protein (1-42) (mouse — structured English B2B identity and sourcing information for research use or qualified development. Final grade, specification, documents and availability are confirmed per inquiry.

CAS166090-74-0Project scopeResearch use or qualified development

Request Quote & Documents

IDENTITY & SPECIFICATION

Product Parameters

Catalog numberConfirm against the current product specification
CAS number166090-74-0
SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
One-letter sequenceNH2-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Molecular formulaConfirm against the current product specification
Molecular weight4418.01
Available purityConfirm against the current product specification
AppearanceConfirm against the current product specification
Storage guidanceConfirm against the current product specification

Supply & Quality Options

Supply format

Lyophilized powder, bulk material, development sample or custom-filled vial, subject to technical feasibility.

Quality package

Current specification and batch COA; TDS, SDS and analytical documentation are confirmed by product and project.

Custom development

Purity, salt form, fill quantity, packaging, analytical testing and scale can be reviewed for qualified B2B projects.

Shipping controls

Packaging and temperature controls are selected against material stability, route, season and destination requirements.

Product Overview

This catalog entry supports qualified B2B sourcing and technical evaluation. Identity data is organized for product matching; final salt form, purity, analytical methods, manufacturing grade, packaging and regulatory documentation are confirmed against the current quotation and quality agreement.

Documentation Available for Review

  • Current product specification and identity confirmation
  • Batch-specific certificate of analysis where applicable
  • Analytical documentation aligned to the agreed quality package
  • Storage, packaging and shipment guidance
  • GMP, sterile, clinical or injectable-development documentation when specifically applicable and contracted

Commercial Information

MOQ, sample quantity, lead time, packaging, shipping conditions and recurring supply plans are quoted against the required grade, quantity and destination. Custom synthesis and scale-up can be evaluated from the target identity and quality brief.

Professional-use and regulatory notice

For laboratory research or qualified development unless another grade and regulatory pathway are expressly confirmed in the quotation and quality agreement. Not supplied as a consumer self-use product.

Scroll to Top